PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013596410.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family MYB
Protein Properties Length: 325aa    MW: 37026.2 Da    PI: 5.4651
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013596410.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.8e-172875148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd +l +++  lG g+W++ ar+ g++Rt+k+c++rw++yl
   XP_013596410.1 28 RGPWTVEEDFKLSNYISTLGEGRWNSLARCAGLKRTGKSCRLRWLNYL 75
                     89********************************************97 PP

2Myb_DNA-binding50.54.9e-1681124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   XP_013596410.1  81 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 124
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.6732375IPR017930Myb domain
SuperFamilySSF466893.02E-3025122IPR009057Homeodomain-like
SMARTSM007175.1E-142777IPR001005SANT/Myb domain
PfamPF002494.9E-152875IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-222982IPR009057Homeodomain-like
CDDcd001675.18E-113075No hitNo description
PROSITE profilePS5129423.17376130IPR017930Myb domain
SMARTSM007172.9E-1480128IPR001005SANT/Myb domain
PfamPF002498.1E-1581124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.7E-2283129IPR009057Homeodomain-like
CDDcd001672.53E-7101124No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDGKRSFEIN KNMGDFENNV DDEMDLRRGP WTVEEDFKLS NYISTLGEGR WNSLARCAGL  60
KRTGKSCRLR WLNYLRPDIR RGNITLEEQL LILELHSRWG NRWSKIAQYL PGRTDNEIKN  120
YWRTRVQKHA KQLRCDVNSQ QFKDTMRYLW MPRLVERIQA ASASSTTGSA AKFCVTTTTD  180
QFVITSYDDG ANNNNTSIDH LGLTNNPNGY VTSGTSSVTV SPASGLTEYN IGSEVGKIIT  240
SFDPDQSLVG PQILLPSQNY LDDKSGLLNG GLGDMQEQSY PNLFENINGM IPSYSDSFWN  300
IGSDEDFWLL QQQQQQQQLL NNRSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-252512224120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM9756570.0KM975657.1 Brassica napus MYB transcription factor 78-2.1 (MYB78-2.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013596410.10.0PREDICTED: LOW QUALITY PROTEIN: transcription factor MYB108
RefseqXP_013647364.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE11e-115MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0N7AGH40.0A0A0N7AGH4_BRANA; MYB transcription factor 78-2.1
STRINGBra010021.1-P0.0(Brassica rapa)
STRINGBra010022.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49620.11e-127myb domain protein 78